LRRC55 (NM_001005210) Human Recombinant Protein

CAT#: TP321563

Recombinant protein of human leucine rich repeat containing 55 (LRRC55), 20 µg

Product Images

Coomassie blue staining of purified LRRC55 protein (Cat# TP321563). The protein was produced from HEK293T cells transfected with LRRC55 cDNA clone (Cat# RC221563) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221563 representing NM_001005210
  Red=Cloning site Green=Tags(s)
  
  MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAA
  GLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLH
  NNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDL
  DLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAP
  LFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001005210
• Locus ID: 219527
• UniProt ID: Q6ZSA7, A0A494C0H1
• Cytogenetics: 11q12.1
• Refseq Size: 3797
• Refseq ORF: 1023
• Summary: Auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). Modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction, and in the absence of calcium.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane