LUC7L (NM_201412) Human Recombinant Protein

CAT#: TP321529

Recombinant protein of human LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2, 20 µg

Size: 20 ug 100 ug 1 mg


  View other "LUC7L" proteins (7)

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 867.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-LUC7L Antibody - middle region
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "LUC7L"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC221529 representing NM_201412
Red=Cloning site Green=Tags(s)

MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD
YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA
EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF
GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS
RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR
LESSNGKMASRRSEEKEAGEI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_958815
Locus ID 55692
UniProt ID Q9NQ29
Cytogenetics 16p13.3
Refseq Size 1452
Refseq ORF 1113
Synonyms hLuc7B1; Luc7; LUC7B1; SR+89
Summary The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).[supplied by OMIM, Mar 2008]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.