NOVA1 (NM_006489) Human Recombinant Protein
CAT#: TP321328
Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221328 representing NM_006489
Red=Cloning site Green=Tags(s) MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ TIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQT TVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAV ELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGVAAFPAVL SGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGS TAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTL VEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006480 |
Locus ID | 4857 |
UniProt ID | P51513 |
Cytogenetics | 14q12 |
Refseq Size | 3846 |
Refseq ORF | 1449 |
Synonyms | Nova-1 |
Summary | This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400898 | NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC416609 | NOVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY400898 | Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1 |
USD 436.00 |
|
LY416609 | Transient overexpression lysate of neuro-oncological ventral antigen 1 (NOVA1), transcript variant 2 |
USD 665.00 |
|
PH310407 | NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_002506) |
USD 3,255.00 |
|
PH321328 | NOVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006480) |
USD 3,255.00 |
|
TP310407 | Recombinant protein of human neuro-oncological ventral antigen 1 (NOVA1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review