MBNL2 (NM_207304) Human Recombinant Protein
CAT#: TP319730
Recombinant protein of human muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 3, 20 µg
View other "MBNL2" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219730 protein sequence
Red=Cloning site Green=Tags(s) MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLH PPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPG VGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDT SDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPK RQALEKSNGTSAVFNPSVLHYQQALTSAQLQQHAAFIPTDNSEIISRNGMECQESALRITKHCYCTYYPV SSSIELPQTAC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997187 |
Locus ID | 10150 |
UniProt ID | Q5VZF2, A2A3S3 |
Cytogenetics | 13q32.1 |
Refseq Size | 4624 |
Refseq ORF | 1083 |
Synonyms | MBLL; MBLL39; PRO2032 |
Summary | This gene is a member of the muscleblind protein family which was initially described in Drosophila melanogaster. This gene encodes a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. [provided by RefSeq, Mar 2012] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403412 | MBNL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404083 | MBNL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403412 | Transient overexpression lysate of muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 1 |
USD 436.00 |
|
LY404083 | Transient overexpression lysate of muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 3 |
USD 436.00 |
|
PH319730 | MBNL2 MS Standard C13 and N15-labeled recombinant protein (NP_997187) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review