CD147 (BSG) (NM_001728) Human Recombinant Protein
CAT#: TP319464
Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 1, 20 µg
View other "CD147" proteins (12)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219464 representing NM_001728
Red=Cloning site Green=Tags(s) MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQL WDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPG TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPM GTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQ GRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001719 |
Locus ID | 682 |
UniProt ID | P35613 |
Cytogenetics | 19p13.3 |
Refseq Size | 2024 |
Refseq ORF | 1155 |
Synonyms | 5F7; CD147; EMMPRIN; EMPRIN; HAb18G; OK; SLC7A11; TCSF |
Summary | The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403688 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC403695 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419777 | BSG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403688 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 4 |
USD 436.00 |
|
LY403695 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 2 |
USD 436.00 |
|
LY419777 | Transient overexpression lysate of basigin (Ok blood group) (BSG), transcript variant 1 |
USD 436.00 |
|
PH303894 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940991) |
USD 3,255.00 |
|
PH319418 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993) |
USD 3,255.00 |
|
PH319464 | BSG MS Standard C13 and N15-labeled recombinant protein (NP_001719) |
USD 3,255.00 |
|
TP303894 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2, 20 µg |
USD 867.00 |
|
TP319418 | Purified recombinant protein of Homo sapiens basigin (Ok blood group) (BSG), transcript variant 4, 20 µg |
USD 867.00 |
|
TP720365 | Recombinant protein of human basigin (Ok blood group) (BSG), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review