LRP2BP (NM_018409) Human Recombinant Protein

CAT#: TP319339

Recombinant protein of human LRP2 binding protein (LRP2BP), 20 µg

Product Images

Coomassie blue staining of purified LRP2BP protein (Cat# TP319339). The protein was produced from HEK293T cells transfected with LRP2BP cDNA clone (Cat# RC219339) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219339 representing NM_018409
  Red=Cloning site Green=Tags(s)
  
  MKLTSEKLPKNPFYASVSQYAAKNQKFFQWKKEKTDYTHANLVDKALQLLKERILKGDTLAYFLRGQLYF
  EEGWYEEALEQFEEIKEKDHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPCPKARHLKFAAAYNLG
  RAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSEACGNGNLESQ
  GALGLMYLYGQGIRQDTEAALQCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPM
  IAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKACRLNPALADELHSLLIRQRI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060879
• Locus ID: 55805
• UniProt ID: Q9P2M1
• Cytogenetics: 4q35.1
• Refseq Size: 5155
• Refseq ORF: 1041
• Summary: May act as an adapter that regulates LRP2 function.[UniProtKB/Swiss-Prot Function]