IFRD1 (NM_001550) Human Recombinant Protein
CAT#: TP317538
Recombinant protein of human interferon-related developmental regulator 1 (IFRD1), transcript variant 1, 20 µg
View other "IFRD1" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217538 protein sequence
Red=Cloning site Green=Tags(s) MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEV LDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSD EQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYS TLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDV NMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF ERHLYNSAAFKARTKARSKCRDKRADVGEFF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001541 |
Locus ID | 3475 |
UniProt ID | O00458, A4D0U1 |
Cytogenetics | 7q31.1 |
Refseq Size | 3305 |
Refseq ORF | 1353 |
Synonyms | PC4; TIS7 |
Summary | This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419866 | IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423466 | IFRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419866 | Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 1 |
USD 436.00 |
|
LY423466 | Transient overexpression lysate of interferon-related developmental regulator 1 (IFRD1), transcript variant 2 |
USD 436.00 |
|
PH317538 | IFRD1 MS Standard C13 and N15-labeled recombinant protein (NP_001541) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review