CEACAM3 (NM_001815) Human Recombinant Protein
CAT#: TP317469
Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), 20 µg
View other "CEACAM3" proteins (4)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217469 protein sequence
Red=Cloning site Green=Tags(s) MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001806 |
Locus ID | 1084 |
UniProt ID | P40198 |
Cytogenetics | 19q13.2 |
Refseq Size | 1163 |
Refseq ORF | 756 |
Synonyms | CD66D; CEA; CGM1; W264; W282 |
Summary | This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2013] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419723 | CEACAM3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419723 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) |
USD 436.00 |
|
PH317469 | CEACAM3 MS Standard C13 and N15-labeled recombinant protein (NP_001806) |
USD 3,255.00 |
|
TP720376 | Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review