ANKRD45 (NM_198493) Human Recombinant Protein

CAT#: TP316235M

Recombinant protein of human ankyrin repeat domain 45 (ANKRD45), 100 µg

Product Images

Coomassie blue staining of purified ANKRD45 protein (Cat# TP316235). The protein was produced from HEK293T cells transfected with ANKRD45 cDNA clone (Cat# RC216235) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216235 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPENPHHEQAMQLL
  LEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALN
  FREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEW
  LETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_940895
• Locus ID: 339416
• UniProt ID: Q5TZF3
• Cytogenetics: 1q25.1
• Refseq Size: 2671
• Refseq ORF: 798
• Synonyms: CT117