H2BC1 (NM_170610) Human Recombinant Protein
CAT#: TP315946
Recombinant protein of human histone cluster 1, H2ba (HIST1H2BA), 20 µg
View other "H2BC1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215946 protein sequence
Red=Cloning site Green=Tags(s) MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTD IFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_733759 |
Locus ID | 255626 |
UniProt ID | Q96A08 |
Cytogenetics | 6p22.2 |
Refseq Size | 437 |
Refseq ORF | 381 |
Synonyms | bA317E16.3; H2BFU; HIST1H2BA; hTSH2B; STBP; TH2B; TSH2B; TSH2B.1 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406917 | HIST1H2BA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406917 | Transient overexpression lysate of histone cluster 1, H2ba (HIST1H2BA) |
USD 436.00 |
|
PH315946 | HIST1H2BA MS Standard C13 and N15-labeled recombinant protein (NP_733759) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review