Septin 3 (SEPT3) (NM_145733) Human Recombinant Protein

CAT#: TP315771M

Recombinant protein of human septin 3 (SEPT3), transcript variant A, 100 µg

Product Images

Coomassie blue staining of purified SEPTIN3 protein (Cat# TP315771). The protein was produced from HEK293T cells transfected with SEPTIN3 cDNA clone (Cat# RC215771) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215771 representing NM_145733
  Red=Cloning site Green=Tags(s)
  
  MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQS
  GLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWE
  PIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKAD
  TMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGR
  KTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVP
  ATPCPTAE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663786
• Locus ID: 55964
• UniProt ID: Q9UH03
• Cytogenetics: 22q13.2
• Refseq Size: 2469
• Refseq ORF: 1074
• Synonyms: bK250D10.3; SEP3; SEPT3
• Summary: This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, May 2018]