Calcitonin (CALCA) (NM_001741) Human Recombinant Protein
CAT#: TP314594
Recombinant protein of human calcitonin-related polypeptide alpha (CALCA), transcript variant 1, 20 µg
View other "Calcitonin" proteins (8)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214594 protein sequence
Red=Cloning site Green=Tags(s) MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNA N myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001732 |
Locus ID | 796 |
UniProt ID | P01258 |
Cytogenetics | 11p15.2 |
Refseq Size | 792 |
Refseq ORF | 423 |
Synonyms | CALC1; CGRP; CGRP-alpha; CGRP-I; CGRP1; CT; KC; PCT |
Summary | This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419771 | CALCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422430 | CALCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419771 | Transient overexpression lysate of calcitonin-related polypeptide alpha (CALCA), transcript variant 1 |
USD 436.00 |
|
LY422430 | Transient overexpression lysate of calcitonin-related polypeptide alpha (CALCA), transcript variant 2 |
USD 436.00 |
|
PH314594 | CALCA MS Standard C13 and N15-labeled recombinant protein (NP_001732) |
USD 3,255.00 |
|
TP720503 | Recombinant protein of human calcitonin-related polypeptide alpha (CALCA) |
USD 330.00 |
|
TP720989 | Purified recombinant protein of Human calcitonin-related polypeptide alpha (CALCA), transcript variant 2 |
USD 330.00 |
|
TP750123 | Purified recombinant protein of Human calcitonin-related polypeptide alpha (PCT), transcript variant 1, N-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review