FAM9B (NM_205849) Human Recombinant Protein

CAT#: TP313736L

Recombinant protein of human family with sequence similarity 9, member B (FAM9B), 1 mg

Product Images

Coomassie blue staining of purified FAM9B protein (Cat# TP313736). The protein was produced from HEK293T cells transfected with FAM9B cDNA clone (Cat# RC213736) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213736 representing NM_205849
  Red=Cloning site Green=Tags(s)
  
  MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRM
  KMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKK
  WQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_995321
• Locus ID: 171483
• UniProt ID: Q8IZU0, A0A024RBV3
• Cytogenetics: Xp22.31
• Refseq Size: 1339
• Refseq ORF: 558
• Synonyms: TEX39B
• Summary: This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein. [provided by RefSeq, Aug 2011]