ACSL5 (NM_203379) Human Recombinant Protein
CAT#: TP313380
Recombinant protein of human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 2, 20 µg
View other "ACSL5" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213380 protein sequence
Red=Cloning site Green=Tags(s) MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKMLFIFNFLFSPLPT PALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRG LAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYT YSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGE KSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYE PTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQN EAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAA MGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGY LKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVH GESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLH PEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 75.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_976313 |
Locus ID | 51703 |
UniProt ID | Q9ULC5 |
Cytogenetics | 10q25.2 |
Refseq Size | 3233 |
Refseq ORF | 2220 |
Synonyms | ACS2; ACS5; FACL5 |
Summary | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404321 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC404322 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC414108 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404321 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 2 |
USD 665.00 |
|
LY404322 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 3 |
USD 665.00 |
|
LY414108 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 1 |
USD 436.00 |
|
PH313380 | ACSL5 MS Standard C13 and N15-labeled recombinant protein (NP_976313) |
USD 3,255.00 |
|
PH318932 | ACSL5 MS Standard C13 and N15-labeled recombinant protein (NP_976314) |
USD 3,255.00 |
|
TP318932 | Recombinant protein of human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review