GATD1 (NM_182612) Human Recombinant Protein

CAT#: TP313338M

Recombinant protein of human Parkinson disease 7 domain containing 1 (PDDC1), 100 µg

Product Images

Coomassie blue staining of purified GATD1 protein (Cat# TP313338). The protein was produced from HEK293T cells transfected with GATD1 cDNA clone (Cat# RC213338) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213338 representing NM_182612
  Red=Cloning site Green=Tags(s)
  
  MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESNARWVQDFRLK
  AYASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKPICAVGHGVAALCCATNEDRS
  WVFDSYSLTGPSVCELVRAPGFARLPLVVEDFVKDSGACFSASEPDAVHVVLDRHLVTGQNASSTVPAVQ
  NLLFLCGSRK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_872418
• Locus ID: 347862
• UniProt ID: Q8NB37, B7Z1J9
• Cytogenetics: 11p15.5
• Refseq Size: 2598
• Refseq ORF: 660
• Synonyms: PDDC1
• Protein Families: Protease