CAPSL (NM_144647) Human Recombinant Protein
CAT#: TP311974
Recombinant protein of human calcyphosine-like (CAPSL), transcript variant 1, 20 µg
View other "CAPSL" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211974 protein sequence
Red=Cloning site Green=Tags(s) MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEV EELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQN GEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653248 |
Locus ID | 133690 |
UniProt ID | Q8WWF8 |
Cytogenetics | 5p13.2 |
Refseq Size | 1019 |
Refseq ORF | 594 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408188 | CAPSL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC421009 | CAPSL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408188 | Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 1 |
USD 436.00 |
|
LY421009 | Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 2 |
USD 436.00 |
|
PH305410 | CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_001036090) |
USD 3,255.00 |
|
PH311974 | CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_653248) |
USD 3,255.00 |
|
TP305410 | Recombinant protein of human calcyphosine-like (CAPSL), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review