ZSCAN2 (NM_001007072) Human Recombinant Protein

CAT#: TP311929M

Recombinant protein of human zinc finger and SCAN domain containing 2 (ZSCAN2), transcript variant 3, 100 µg

Product Images

Coomassie blue staining of purified ZSCAN2 protein (Cat# TP311929). The protein was produced from HEK293T cells transfected with ZSCAN2 cDNA clone (Cat# RC211929) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211929 representing NM_001007072
  Red=Cloning site Green=Tags(s)
  
  MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVT
  RGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSETASC
  VHGCPV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001007073
• Locus ID: 54993
• UniProt ID: Q7Z7L9
• Cytogenetics: 15q25.2
• Refseq Size: 951
• Refseq ORF: 438
• Synonyms: ZFP29; ZNF854
• Summary: The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors