CYP4B1 (NM_001099772) Human Recombinant Protein
CAT#: TP311671
Recombinant protein of human cytochrome P450, family 4, subfamily B, polypeptide 1 (CYP4B1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211671 protein sequence
Red=Cloning site Green=Tags(s) MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKV VSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKL LTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHSRDS SYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQN RRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREIL GDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVW PDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQ LVLRSKNGFHLHLKPLGPGSGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001093242 |
Locus ID | 1580 |
UniProt ID | P13584 |
Cytogenetics | 1p33 |
Refseq Size | 2173 |
Refseq ORF | 1536 |
Synonyms | CYPIVB1; P-450HP |
Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, P450, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424521 | CYP4B1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424521 | Transient overexpression lysate of cytochrome P450, family 4, subfamily B, polypeptide 1 (CYP4B1), transcript variant 2 |
USD 436.00 |
|
PH311671 | CYP4B1 MS Standard C13 and N15-labeled recombinant protein (NP_001093242) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review