WFDC6 (NM_080827) Human Recombinant Protein
CAT#: TP310952
Recombinant protein of human WAP four-disulfide core domain 6 (WFDC6), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210952 protein sequence
Red=Cloning site Green=Tags(s) MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCL DFRKVSLTLYHKEELE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_543017 |
Locus ID | 140870 |
UniProt ID | Q9BQY6, A0A0K0K1K0 |
Cytogenetics | 20q13.12 |
Refseq Size | 619 |
Refseq ORF | 258 |
Synonyms | C20orf171; dJ461P17.11; HEL-S-295; WAP6 |
Summary | This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Read-through transcription exists between this gene and the upstream SPINLW1 (serine peptidase inhibitor-like, with Kunitz and WAP domains 1) gene. [provided by RefSeq, Nov 2010] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409030 | WFDC6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409030 | Transient overexpression lysate of WAP four-disulfide core domain 6 (WFDC6) |
USD 436.00 |
|
PH310952 | WFDC6 MS Standard C13 and N15-labeled recombinant protein (NP_543017) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review