Epsin 2 (EPN2) (NM_148921) Human Recombinant Protein
CAT#: TP310899
Recombinant protein of human epsin 2 (EPN2), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210899 protein sequence
Red=Cloning site Green=Tags(s) MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKN WRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERL KAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQ ARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDL MDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKN SDPWAASQQPASSAGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSL PSQNNGTTSPDPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPAT SAPVNPFQVNQPQPLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMM NMVGSVGIPPSAAQATGTTNPFLL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 62.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_683723 |
Locus ID | 22905 |
UniProt ID | O95208 |
Cytogenetics | 17p11.2 |
Refseq Size | 4664 |
Refseq ORF | 1752 |
Synonyms | EHB21 |
Summary | This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407732 | EPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420185 | EPN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407732 | Transient overexpression lysate of epsin 2 (EPN2), transcript variant 1 |
USD 436.00 |
|
LY420185 | Transient overexpression lysate of epsin 2 (EPN2), transcript variant 3 |
USD 436.00 |
|
PH310899 | EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_683723) |
USD 3,255.00 |
|
PH313652 | EPN2 MS Standard C13 and N15-labeled recombinant protein (NP_055779) |
USD 3,255.00 |
|
TP313652 | Recombinant protein of human epsin 2 (EPN2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review