FLJ43980 (NM_001004299) Human Recombinant Protein

CAT#: TP309893

Recombinant protein of human FLJ43980 protein (FLJ43980), 20 µg

Size: 20 ug 100 ug 1 mg


  View other "FLJ43980" proteins (4)

USD 867.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "FLJ43980"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC209893 representing NM_001004299
Red=Cloning site Green=Tags(s)

MRRSSGFGGQKGQGPSCSFTGCWCCRGDDVAESDDSPFAQCGYNIQEKHLGKLHRAASRGEVSKVECILS
SGSADLDERDKKKRTALHLACANGHPEVVALLVDRGCQLDVFDNKNRTALLKAVQCQEEECATILLEHGA
DPDLPDVYGNTTLHYAIYNEDIPMTKKLLLHHANIESANKDELTPFLLAVHEQKQQMEDFLRKQKENLTA
VKLESIHQVMSEYKENETPRNPQNSNPEGTSNKMACLGEGAAGAKVDEIPGNPVTRLFNKPSIDDSRPMS
ANEDFDFDTEEKATEPANGKRQNGMGIIESAPQEHTNNENI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.9
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001004299
Locus ID 124149
Cytogenetics 16q11.2
Refseq Size 3722
Refseq ORF 963
Synonyms MGC87661, DKFZp781D1722

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.