MRPL54 (NM_172251) Human Recombinant Protein
CAT#: TP308976
Recombinant protein of human mitochondrial ribosomal protein L54 (MRPL54), nuclear gene encoding mitochondrial protein, 20 µg
View other "MRPL54" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208976 protein sequence
Red=Cloning site Green=Tags(s) MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTT YAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_758455 |
Locus ID | 116541 |
UniProt ID | Q6P161 |
Cytogenetics | 19p13.3 |
Refseq Size | 628 |
Refseq ORF | 414 |
Synonyms | L54mt; MRP-L54 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406705 | MRPL54 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406705 | Transient overexpression lysate of mitochondrial ribosomal protein L54 (MRPL54), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
PH308976 | MRPL54 MS Standard C13 and N15-labeled recombinant protein (NP_758455) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review