Cathelicidin (CAMP) (NM_004345) Human Recombinant Protein
CAT#: TP308872
Recombinant protein of human cathelicidin antimicrobial peptide (CAMP), 20 µg
View other "Cathelicidin" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208872 protein sequence
Red=Cloning site Green=Tags(s) MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR KSKEKIGKEFKRIVQRIKDFLRNLVPRTES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004336 |
Locus ID | 820 |
UniProt ID | P49913, J3KNB4, A0A384NPR0 |
Cytogenetics | 3p21.31 |
Refseq Size | 758 |
Refseq ORF | 510 |
Synonyms | CAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37 |
Summary | This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401385 | CAMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401385 | Transient overexpression lysate of cathelicidin antimicrobial peptide (CAMP) |
USD 436.00 |
|
PH308872 | CAMP MS Standard C13 and N15-labeled recombinant protein (NP_004336) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review