LYZL6 (NM_020426) Human Recombinant Protein

CAT#: TP308863M

Recombinant protein of human lysozyme-like 6 (LYZL6), 100 µg

Size: 20 ug 100 ug 1 mg


USD 2,950.00

6 Weeks*

Size
    • 100 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-LYZL6 Antibody
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "LYZL6"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC208863 protein sequence
Red=Cloning site Green=Tags(s)

MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSF
DYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFY
WLTGCRLR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_065159
Locus ID 57151
UniProt ID O75951, A0A080YUZ6
Cytogenetics 17q12
Refseq Size 942
Refseq ORF 444
Synonyms HEL-S-6a; LYC1; LYZB; PRO1485; TKAL754; UNQ754
Summary This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.