ZFP200 (ZNF200) (NM_003454) Human Recombinant Protein

CAT#: TP307594M

Recombinant protein of human zinc finger protein 200 (ZNF200), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified ZNF200 protein (Cat# TP307594). The protein was produced from HEK293T cells transfected with ZNF200 cDNA clone (Cat# RC207594) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207594 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETL
  VIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFEDLNVFHCQEECVSLDPTQQLT
  SEKEDDSSVGEMMLLAVNGSNPEGEDPEREPVENEDYREKSSDDDEMDSSLVSQQPPDNQEKERLNTSIP
  QKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPY
  DCNHCGKSFNHKTNLNKHERIHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPKNEE
  FVLHLQSHEAERPYGCKKCGRRFGRLSNCTRHEKTHSACKTRKQK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003445
• Locus ID: 7752
• UniProt ID: P98182, B3KP91
• Cytogenetics: 16p13.3
• Refseq Size: 3387
• Refseq ORF: 1185
• Summary: Could have a role in spermatogenesis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors