Troponin C1 (TNNC1) (NM_003280) Human Recombinant Protein
CAT#: TP307014
Recombinant protein of human troponin C type 1 (slow) (TNNC1), 20 µg
View other "Troponin C1" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207014 protein sequence
Red=Cloning site Green=Tags(s) MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSG TVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDG DKNNDGRIDYDEFLEFMKGVE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003271 |
Locus ID | 7134 |
UniProt ID | P63316, Q6FH91 |
Cytogenetics | 3p21.1 |
Refseq Size | 705 |
Refseq ORF | 483 |
Synonyms | CMD1Z; CMH13; TN-C; TNC; TNNC |
Summary | Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. [provided by RefSeq, Oct 2008] |
Protein Pathways | Calcium signaling pathway, Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401131 | TNNC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401131 | Transient overexpression lysate of troponin C type 1 (slow) (TNNC1) |
USD 436.00 |
|
PH307014 | TNNC1 MS Standard C13 and N15-labeled recombinant protein (NP_003271) |
USD 3,255.00 |
|
TP710218 | Purified recombinant protein of Human troponin C type 1 (slow) (TNNC1), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review