MOB4A (MOB1B) (NM_173468) Human Recombinant Protein

CAT#: TP306337

Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1A (yeast) (MOBKL1A), 20 µg

Product Images

Coomassie blue staining of purified MOB1B protein (Cat# TP306337). The protein was produced from HEK293T cells transfected with MOB1B cDNA clone (Cat# RC206337) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206337 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM
  LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF
  PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
  LTSKDR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_775739
• Locus ID: 92597
• UniProt ID: Q7L9L4
• Cytogenetics: 4q13.3
• Refseq Size: 6979
• Refseq ORF: 648
• Synonyms: MATS2; MOB4A; MOBKL1A
• Summary: The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]