MRPS16 (NM_016065) Human Recombinant Protein
CAT#: TP305837
Recombinant protein of human mitochondrial ribosomal protein S16 (MRPS16), nuclear gene encoding mitochondrial protein, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205837 protein sequence
Red=Cloning site Green=Tags(s) MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNL DRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057149 |
Locus ID | 51021 |
UniProt ID | Q9Y3D3 |
Cytogenetics | 10q22.2 |
Refseq Size | 2651 |
Refseq ORF | 411 |
Synonyms | CGI-132; COXPD2; MRP-S16; RPMS16 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414213 | MRPS16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414213 | Transient overexpression lysate of mitochondrial ribosomal protein S16 (MRPS16), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
PH305837 | MRPS16 MS Standard C13 and N15-labeled recombinant protein (NP_057149) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review