PHF7 (NM_016483) Human Recombinant Protein
CAT#: TP305192
Recombinant protein of human PHD finger protein 7 (PHF7), transcript variant 1, 20 µg
View other "PHF7" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205192 protein sequence
Red=Cloning site Green=Tags(s) MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQ RGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSF CDKHRPTQNIQHGHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNR KEFPQEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHG THRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPS LLEKPESSRGRRSYSWRSKGVRITNSCKKSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057567 |
Locus ID | 51533 |
UniProt ID | Q9BWX1, A0A024R336 |
Cytogenetics | 3p21.1 |
Refseq Size | 2240 |
Refseq ORF | 1143 |
Synonyms | HSPC045; HSPC226; NYD-SP6 |
Summary | Spermatogenesis is a complex process regulated by extracellular and intracellular factors as well as cellular interactions among interstitial cells of the testis, Sertoli cells, and germ cells. This gene is expressed in the testis in Sertoli cells but not germ cells. The protein encoded by this gene contains plant homeodomain (PHD) finger domains, also known as leukemia associated protein (LAP) domains, believed to be involved in transcriptional regulation. The protein, which localizes to the nucleus of transfected cells, has been implicated in the transcriptional regulation of spermatogenesis. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402558 | PHF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC406629 | PHF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402558 | Transient overexpression lysate of PHD finger protein 7 (PHF7), transcript variant 1 |
USD 436.00 |
|
LY406629 | Transient overexpression lysate of PHD finger protein 7 (PHF7), transcript variant 2 |
USD 436.00 |
|
PH305192 | PHF7 MS Standard C13 and N15-labeled recombinant protein (NP_057567) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review