PC4 (SUB1) (NM_006713) Human Recombinant Protein
CAT#: TP304999
Recombinant protein of human SUB1 homolog (S. cerevisiae) (SUB1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204999 protein sequence
Red=Cloning site Green=Tags(s) MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMR YVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006704 |
Locus ID | 10923 |
UniProt ID | P53999, Q6IBA2 |
Cytogenetics | 5p13.3 |
Refseq Size | 3522 |
Refseq ORF | 381 |
Synonyms | p14; P15; PC4 |
Summary | General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402009 | SUB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402009 | Transient overexpression lysate of SUB1 homolog (S. cerevisiae) (SUB1) |
USD 436.00 |
|
PH304999 | SUB1 MS Standard C13 and N15-labeled recombinant protein (NP_006704) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review