LAGE3 (NM_006014) Human Recombinant Protein

CAT#: TP304863

Purified recombinant protein of Homo sapiens L antigen family, member 3 (LAGE3), 20 µg

Product Images

Coomassie blue staining of purified LAGE3 protein (Cat# TP304863). The protein was produced from HEK293T cells transfected with LAGE3 cDNA clone (Cat# RC204863) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204863 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFP
  TPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPP
  VSR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006005
• Locus ID: 8270
• UniProt ID: Q14657
• Cytogenetics: Xq28
• Refseq Size: 964
• Refseq ORF: 429
• Synonyms: CVG5; DXS9879E; DXS9951E; ESO3; GAMOS2; ITBA2; Pcc1
• Summary: This gene belongs to the ESO/LAGE gene family, members of which are clustered together on chromosome Xq28, and have similar exon-intron structures. Unlike the other family members which are normally expressed only in testis and activated in a wide range of human tumors, this gene is ubiquitously expressed in somatic tissues. The latter, combined with the finding that it is highly conserved in mouse and rat, suggests that the encoded protein is functionally important. An intronless pseudogene with high sequence similarity to this gene is located on chromosome 9. [provided by RefSeq, Jul 2008]