TAX1BP3 (NM_014604) Human Recombinant Protein
CAT#: TP304776
Recombinant protein of human Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204776 protein sequence
Red=Cloning site Green=Tags(s) MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055419 |
Locus ID | 30851 |
UniProt ID | O14907 |
Cytogenetics | 17p13.2 |
Refseq Size | 1398 |
Refseq ORF | 372 |
Synonyms | TIP-1; TIP1 |
Summary | This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter functions. The encoded protein interacts with a large number of target proteins that play roles in signaling pathways; for example, it interacts with Rho A and glutaminase L and also acts as a negative regulator of the Wnt/beta-catenin signaling pathway. This protein was first identified as binding to the T-cell leukaemia virus (HTLV1) Tax oncoprotein. Overexpression of this gene has been implicated in altered cancer cell adhesion, migration and metastasis. The encoded protein also modulates the localization and density of inwardly rectifying potassium channel 2.3 (Kir2.3). To date, this protein has been shown to play a role in cell proliferation, development, stress response, and polarization. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415159 | TAX1BP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415159 | Transient overexpression lysate of Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3) |
USD 436.00 |
|
PH304776 | TAX1BP3 MS Standard C13 and N15-labeled recombinant protein (NP_055419) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review