FAM114A1 (NM_138389) Human Recombinant Protein

CAT#: TP303837

Recombinant protein of human family with sequence similarity 114, member A1 (FAM114A1), 20 µg

Product Images

Coomassie blue staining of purified FAM114A1 protein (Cat# TP303837). The protein was produced from HEK293T cells transfected with FAM114A1 cDNA clone (Cat# RC203837) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203837 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDDAGDTLATGDKAEVTEMPNSDSLPEDAEVHCDSAAVSHEPTPADPRGEGHENAAVQGAGAAAIGPPV
  QPQDANALEPPLNRDVTEDTLAECIDSVSLEAEPRSEIPLQEQNYPAVDSPPSGGGWAGWGSWGKSLLSS
  ASATVGHGLTAVKEKAGATLRIHGVNSGSSEGAQPNTENGVPEITDAATDQGPAESPPTSPSSASRGMLS
  AITNVVQNTGKSVLTGGLDALEFIGKKTMNVLAESDPGFKRTKTLMERTVSLSQMLREAKEKEKQRLAQQ
  LTMERTAHYGMLFDEYQGLSHLEALEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENE
  ENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEK
  EEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLT
  TAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYIQDAFQLLLPVLQVSHIQTSCLK
  AQP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 60.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612398
• Locus ID: 92689
• UniProt ID: Q8IWE2, A1MMZ0, Q6MZV4
• Cytogenetics: 4p14
• Refseq Size: 4138
• Refseq ORF: 1689
• Synonyms: Noxp20
• Summary: The protein encoded by this gene belongs to the FAM114 family and may play a role in neuronal cell development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]