Dystrobrevin beta (DTNB) (NM_183361) Human Recombinant Protein
CAT#: TP303798
Recombinant protein of human dystrobrevin, beta (DTNB), transcript variant 5, 20 µg
View other "Dystrobrevin beta" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203798 protein sequence
Red=Cloning site Green=Tags(s) MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTL DHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMC GGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRKIMLNMFL DTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPH SNQHQMKEHSSWKSPAKKLSHAISKSLGCVPTREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHM SSGVPTPTKSVLDSPSRLDEEHRLIARYAARLAAEAGNVTRPPTDLSFNFDANKQQRQLIAELENKNREI LQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQ ATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQAEEGAEEEEEKMQNGKDRG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_899205 |
Locus ID | 1838 |
UniProt ID | O60941 |
Cytogenetics | 2p23.3 |
Refseq Size | 2328 |
Refseq ORF | 1680 |
Summary | This gene encodes dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin. [provided by RefSeq, Mar 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405251 | DTNB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC409709 | DTNB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY405251 | Transient overexpression lysate of dystrobrevin, beta (DTNB), transcript variant 5 |
USD 436.00 |
|
LY409709 | Transient overexpression lysate of dystrobrevin, beta (DTNB), transcript variant 2 |
USD 665.00 |
|
PH303798 | DTNB MS Standard C13 and N15-labeled recombinant protein (NP_899205) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review