PELO (NM_015946) Human Recombinant Protein

CAT#: TP303592

Recombinant protein of human pelota homolog (Drosophila) (PELO), 20 µg

Product Images

Coomassie blue staining of purified PELO protein (Cat# TP303592). The protein was produced from HEK293T cells transfected with PELO cDNA clone (Cat# RC203592) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203592 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVE
  AIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAV
  VMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASP
  GFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDD
  FYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLH
  VSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057030
• Locus ID: 53918
• UniProt ID: Q9BRX2
• Cytogenetics: 5q11.2
• Refseq Size: 2941
• Refseq ORF: 1155
• Synonyms: CGI-17; PRO1770
• Summary: This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome