HSD17B2 (NM_002153) Human Recombinant Protein

CAT#: TP303293L

Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 2 (HSD17B2), 1 mg

Size: 20 ug 100 ug 1 mg


USD 9,200.00

5 Days*

Size
    • 1 mg

Product Images

Frequently bought together (2)
HSD17B2 mouse monoclonal antibody, clone OTI4F10 (formerly 4F10)
    • 100 ul

USD 447.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "HSD17B2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC203293 protein sequence
Red=Cloning site Green=Tags(s)

MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT
YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT
KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS
KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE
KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL
AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002144
Locus ID 3294
UniProt ID P37059
Cytogenetics 16q23.3
Refseq Size 1451
Refseq ORF 1161
Synonyms EDH17B2; HSD17; SDR9C2
Summary Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Androgen and estrogen metabolism, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.