CCDC115 (NM_032357) Human Recombinant Protein

CAT#: TP302967L

Recombinant protein of human coiled-coil domain containing 115 (CCDC115), 1 mg

Product Images

Coomassie blue staining of purified CCDC115 protein (Cat# TP302967). The protein was produced from HEK293T cells transfected with CCDC115 cDNA clone (Cat# RC202967) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202967 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLH
  ASEAQEGLQKFKVVRAGVHAPEEVGPREAGLRRRKGPTKTPEPESSEAPQDPLNWFGILVPHSLRQAQAS
  FRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115733
• Locus ID: 84317
• UniProt ID: Q96NT0, A1QKJ6
• Cytogenetics: 2q21.1
• Refseq Size: 2000
• Refseq ORF: 540
• Synonyms: ccp1; CDG2O
• Summary: The protein encoded by this gene has been observed to localize to the endoplasmic reticulum (ER)-Golgi intermediate compartment (ERGIC) and coat protein complex I (COPI) vesicles in some human cells. The encoded protein shares some homology with the yeast V-ATPase assembly factor Vma22p, and the orthologous protein in mouse promotes cell proliferation and suppresses cell death. Defects in this gene are a cause of congenital disorder of glycosylation, type IIo in humans. [provided by RefSeq, Mar 2016]