Guanylate kinase (GUK1) (NM_000858) Human Recombinant Protein
CAT#: TP302510
Recombinant protein of human guanylate kinase 1 (GUK1), 20 µg
View other "Guanylate kinase" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202510 protein sequence
Red=Cloning site Green=Tags(s) MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDF IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTE TEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000849 |
Locus ID | 2987 |
UniProt ID | Q16774, Q6IBG8 |
Cytogenetics | 1q42.13 |
Refseq Size | 1155 |
Refseq ORF | 591 |
Synonyms | GMK |
Summary | The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400303 | GUK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431782 | GUK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400303 | Transient overexpression lysate of guanylate kinase 1 (GUK1), transcript variant 2 |
USD 436.00 |
|
LY431782 | Transient overexpression lysate of guanylate kinase 1 (GUK1), transcript variant 3 |
USD 436.00 |
|
PH302510 | GUK1 MS Standard C13 and N15-labeled recombinant protein (NP_000849) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review