SERPINB6 (NM_004568) Human Recombinant Protein
CAT#: TP300668
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200668 representing NM_004568
Red=Cloning site Green=Tags(s) MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQ GFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAE KTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTY IGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESY DMESVLRNLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFC ADHPFLFFIQHSKTNGILFCGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004559 |
Locus ID | 5269 |
UniProt ID | P35237, A0A024QZX3 |
Cytogenetics | 6p25.2 |
Refseq Size | 1665 |
Refseq ORF | 1128 |
Synonyms | CAP; DFNB91; MSTP057; PI-6; PI6; PTI; SPI3 |
Summary | The protein encoded by this gene is a member of the serpin (serine proteinase inhibitor) superfamily, and ovalbumin(ov)-serpin subfamily. It was originally discovered as a placental thrombin inhibitor. The mouse homolog was found to be expressed in the hair cells of the inner ear. Mutations in this gene are associated with nonsyndromic progressive hearing loss, suggesting that this serpin plays an important role in the inner ear in the protection against leakage of lysosomal content during stress, and that loss of this protection results in cell death and sensorineural hearing loss. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417897 | SERPINB6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417897 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) |
USD 436.00 |
|
PH300668 | SERPINB6 MS Standard C13 and N15-labeled recombinant protein (NP_004559) |
USD 3,255.00 |
|
TP720554 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 6 (SERPINB6) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review