NECAP2 (NM_001145277) Human Mass Spec Standard
CAT#: PH327659
NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138749)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227659 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC227659 representing NM_001145277
Red=Cloning site Green=Tags(s) MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQ APVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQ NPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVG GSLVQPAVAPSSDQLPARPSQAQAGSSSDLSTVFPHVTSGKALPHLGQRKEDEALLSWPVFGA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001138749 |
RefSeq ORF | 819 |
Locus ID | 55707 |
UniProt ID | Q9NVZ3 |
Cytogenetics | 1p36.13 |
Summary | This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428781 | NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428782 | NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY428781 | Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 2 |
USD 436.00 |
|
LY428782 | Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 3 |
USD 436.00 |
|
PH327668 | NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138750) |
USD 3,255.00 |
|
TP327659 | Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 2, 20 µg |
USD 867.00 |
|
TP327668 | Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 3, 20 µg |
USD 867.00 |
|
TP721003 | Purified recombinant protein of Human NECAP endocytosis associated 2 (NECAP2), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review