SSX3 (NM_021014) Human Mass Spec Standard

CAT#: PH324933

SSX3 MS Standard C13 and N15-labeled recombinant protein (NP_066294)

Product Images

Coomassie blue staining of purified SSX3 protein (Cat# TP324933). The protein was produced from HEK293T cells transfected with SSX3 cDNA clone (Cat# RC224933) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224933
• Predicted MW: 21.7 kDa
• Protein Sequence:
  Sequence Link

  >RC224933 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSF
  MRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLC
  PPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066294
• RefSeq Size: 1336
• RefSeq ORF: 564
• Synonyms: CT5.3
• Locus ID: 10214
• UniProt ID: Q99909
• Cytogenetics: Xp11.23
• Summary: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. [provided by RefSeq, Jul 2013]
• Protein Families: Transcription Factors