PRLH (NM_015893) Human Mass Spec Standard
CAT#: PH323400
PRLH MS Standard C13 and N15-labeled recombinant protein (NP_056977)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223400 |
Predicted MW | 9.6 kDa |
Protein Sequence |
>RC223400 protein sequence
Red=Cloning site Green=Tags(s) MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRP RLTCFPLEGGAMSSQDG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056977 |
RefSeq Size | 264 |
RefSeq ORF | 263 |
Synonyms | PRH; PRRP |
Locus ID | 51052 |
UniProt ID | P81277, Q53QV7 |
Cytogenetics | 2q37.3 |
Summary | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414287 | PRLH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414287 | Transient overexpression lysate of prolactin releasing hormone (PRLH) |
USD 436.00 |
|
TP323400 | Recombinant protein of human prolactin releasing hormone (PRLH), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review