PEAMT (PEMT) (NM_007169) Human Mass Spec Standard
CAT#: PH323190
PEMT MS Standard C13 and N15-labeled recombinant protein (NP_009100)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223190 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC223190 representing NM_007169
Red=Cloning site Green=Tags(s) MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTILLLNFLRSHC FTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGDYFGILKEARVTVFPFNILDN PMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009100 |
RefSeq Size | 1008 |
RefSeq ORF | 597 |
Synonyms | PEAMT; PEMPT; PEMT2; PLMT; PNMT |
Locus ID | 10400 |
UniProt ID | Q9UBM1 |
Cytogenetics | 17p11.2 |
Summary | Phosphatidylcholine (PC) is the most abundant mammalian phospholipid. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. Another distinct synthetic pathway in nucleated cells converts intracellular choline to phosphatidylcholine by a three-step process. The protein isoforms encoded by this gene localize to the endoplasmic reticulum and mitochondria-associated membranes. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2012] |
Protein Families | Transmembrane |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402097 | PEMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407769 | PEMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407770 | PEMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402097 | Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
LY407769 | Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY407770 | Transient overexpression lysate of phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
TP323190 | Recombinant protein of human phosphatidylethanolamine N-methyltransferase (PEMT), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review