ACRV1 (NM_020107) Human Mass Spec Standard
CAT#: PH322483
ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064492)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222483 |
Predicted MW | 20 kDa |
Protein Sequence |
>RC222483 representing NM_020107
Red=Cloning site Green=Tags(s) MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEPAATEHAEGEHTVGEQPSGEQPSGEHLS GEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAY MNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_064492 |
RefSeq Size | 1173 |
RefSeq ORF | 630 |
Synonyms | D11S4365; SP-10; SPACA2 |
Locus ID | 56 |
UniProt ID | P26436 |
Cytogenetics | 11q24.2 |
Summary | This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402748 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC412644 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC412647 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC412655 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419846 | ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402748 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 8 |
USD 436.00 |
|
LY412644 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 3 |
USD 436.00 |
|
LY412647 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 10 |
USD 436.00 |
|
LY412655 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 2 |
USD 436.00 |
|
LY419846 | Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 1 |
USD 436.00 |
|
PH305185 | ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_001603) |
USD 3,255.00 |
|
PH313557 | ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064495) |
USD 3,255.00 |
|
TP305185 | Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP313557 | Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 10, 20 µg |
USD 867.00 |
|
TP322483 | Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 3, 20 µg |
USD 867.00 |
|
TP720355 | Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 1 |
USD 330.00 |
|
TP761524 | Purified recombinant protein of Human acrosomal vesicle protein 1 (ACRV1), transcript variant 8, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review