RAB23 (NM_183227) Human Mass Spec Standard
CAT#: PH321508
RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_899050)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221508 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC221508 protein sequence
Red=Cloning site Green=Tags(s) MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEE FDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALA KRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLN GGDVINLRPNKQRTKKNRNPFSSCSIP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_899050 |
RefSeq Size | 4391 |
RefSeq ORF | 711 |
Synonyms | HSPC137 |
Locus ID | 51715 |
UniProt ID | Q9ULC3, A0A024RD41 |
Cytogenetics | 6p12.1-p11.2 |
Summary | This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Hedgehog signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402532 | RAB23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405187 | RAB23 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402532 | Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 1 |
USD 436.00 |
|
LY405187 | Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 2 |
USD 436.00 |
|
PH301922 | RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361) |
USD 3,255.00 |
|
TP301922 | Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 1, 20 µg |
USD 867.00 |
|
TP321508 | Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review