PDE4C (NM_001098819) Human Mass Spec Standard

CAT#: PH321103

PDE4C MS Standard C13 and N15-labeled recombinant protein (NP_001092289)

Product Images

Coomassie blue staining of purified PDE4C protein (Cat# TP321103). The protein was produced from HEK293T cells transfected with PDE4C cDNA clone (Cat# RC221103) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221103
• Predicted MW: 67.6 kDa
• Protein Sequence:
  Sequence Link

  >RC221103 representing NM_001098819
  Red=Cloning site Green=Tags(s)
  
  MQAPVPHSQRRESFLYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQ
  CLGAAKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRILNRELT
  HLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQ
  EEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLLKTFQIPADTLATYLLMLEGHYHANVA
  YHNSLHAADVAQSTHVLLATPALEAVFTDLEILAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASV
  LENHHLAVGFKLLQAENCDIFQNLSAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVL
  LLDNYSDRIQVLQNLVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKS
  QVGFIDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFELTLEEAE
  EEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001092289
• RefSeq Size: 5124
• RefSeq ORF: 1818
• Synonyms: DPDE1; PDE21
• Locus ID: 5143
• UniProt ID: Q08493, Q32MM7, Q7KYS4, Q08493-2
• Cytogenetics: 19p13.11
• Summary: The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Progesterone-mediated oocyte maturation, Purine metabolism