IL17E (IL25) (NM_172314) Human Mass Spec Standard
CAT#: PH320754
IL25 MS Standard C13 and N15-labeled recombinant protein (NP_758525)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220754 |
Predicted MW | 16.7 kDa |
Protein Sequence |
>RC220754 representing NM_172314
Red=Cloning site Green=Tags(s) MYQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRA ISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYC LERRLYRVSLACVCVRPRVMG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_758525 |
RefSeq Size | 1187 |
RefSeq ORF | 483 |
Synonyms | IL17E |
Locus ID | 64806 |
UniProt ID | Q9H293 |
Cytogenetics | 14q11.2 |
Summary | The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406709 | IL25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC411546 | IL25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406709 | Transient overexpression lysate of interleukin 25 (IL25), transcript variant 2 |
USD 436.00 |
|
LY411546 | Transient overexpression lysate of interleukin 25 (IL25), transcript variant 1 |
USD 436.00 |
|
TP320754 | Purified recombinant protein of Homo sapiens interleukin 25 (IL25), transcript variant 2, 20 µg |
USD 867.00 |
|
TP762489 | Purified recombinant protein of Human interleukin 25 (IL25), transcript variant 1, 33Tyr-End, with N-terminal His tag, expressed in E.coli, 50ug |
USD 226.00 |
{0} Product Review(s)
Be the first one to submit a review