Nucleobindin 2 (NUCB2) (NM_005013) Human Mass Spec Standard

CAT#: PH320684

NUCB2 MS Standard C13 and N15-labeled recombinant protein (NP_005004)

Product Images

Coomassie blue staining of purified NUCB2 protein (Cat# TP320684). The protein was produced from HEK293T cells transfected with NUCB2 cDNA clone (Cat# RC220684) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220684
• Predicted MW: 50.7 kDa
• Protein Sequence:
  Sequence Link

  >RC220684 representing NM_005013
  Red=Cloning site Green=Tags(s)
  
  MRWRTILLQYCFLLITCLLTALEAVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKH
  FREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFD
  HLNHLNPDKFESTDLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEM
  KKKHENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKELEKVYDP
  KNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEY
  ENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005004
• RefSeq Size: 1612
• RefSeq ORF: 1260
• Synonyms: HEL-S-109; NEFA
• Locus ID: 4925
• UniProt ID: P80303
• Cytogenetics: 11p15.1
• Summary: This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation in the hypothalamus, and release of tumor necrosis factor from vascular endothelial cells. This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
• Protein Families: Secreted Protein, Transmembrane