Achaete scute homolog 3 (ASCL3) (NM_020646) Human Mass Spec Standard

CAT#: PH320042

ASCL3 MS Standard C13 and N15-labeled recombinant protein (NP_065697)

Product Images

Coomassie blue staining of purified ASCL3 protein (Cat# TP320042). The protein was produced from HEK293T cells transfected with ASCL3 cDNA clone (Cat# RC220042) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220042
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC220042 representing NM_020646
  Red=Cloning site Green=Tags(s)
  
  MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSE
  PCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIK
  YINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065697
• RefSeq Size: 650
• RefSeq ORF: 543
• Synonyms: bHLHa42; HASH3; SGN1
• Locus ID: 56676
• UniProt ID: Q9NQ33
• Cytogenetics: 11p15.4
• Summary: Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008]