TCF21 (NM_198392) Human Mass Spec Standard
CAT#: PH320002
TCF21 MS Standard C13 and N15-labeled recombinant protein (NP_938206)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220002 |
Predicted MW | 19.5 kDa |
Protein Sequence |
>RC220002 representing NM_198392
Red=Cloning site Green=Tags(s) MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRRKAPTKKSPLS GVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKY ENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_938206 |
RefSeq Size | 3231 |
RefSeq ORF | 537 |
Synonyms | bHLHa23; POD1 |
Locus ID | 6943 |
UniProt ID | O43680 |
Cytogenetics | 6q23.2 |
Summary | TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405044 | TCF21 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418825 | TCF21 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405044 | Transient overexpression lysate of transcription factor 21 (TCF21), transcript variant 1 |
USD 436.00 |
|
LY418825 | Transient overexpression lysate of transcription factor 21 (TCF21), transcript variant 2 |
USD 436.00 |
|
TP320002 | Recombinant protein of human transcription factor 21 (TCF21), transcript variant 1, 20 µg |
USD 867.00 |
|
TP761400 | Purified recombinant protein of Human transcription factor 21 (TCF21), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review